DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl3b.4

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:288 Identity:110/288 - (38%)
Similarity:151/288 - (52%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCGL 82
            |..||..:.|....|| :..:|..|.:              ...|.:.:.:|:.|..|.......
 Frog    44 LLKALGKSAEKDALAT-EGTVREMPVL--------------GKKSGSVDVFTQISKVNRGISVPT 93

  Fly    83 FEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNAN----QTMVILKAFKEYHDRTCIRFR 143
            :||||:  |...|:.:......||::.....|.|.:|::|    |..:...|.:||...||:||.
 Frog    94 YEGDIL--RPEGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSAMQEYESLTCVRFV 156

  Fly   144 PYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERD 208
            |.........:|.|  |||.|.:|:..|.|.:.|.:..|:..|::.|||.|||||||:||.::||
 Frog   157 PRANETAFLNIISG--SGCVSFLGKLGGAQTVQLASYGCIYRGIIQHELNHALGFYHEQSRSDRD 219

  Fly   209 EYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPL-DPYASLG 272
            :||.|:.||||.|:..|||| |.|:  |.|:||||.|||||...||||||..||.|. ||...:|
 Frog   220 DYVTIHTENILPGYEGNFNK-ANTN--NLGLEYDYSSVMHYPGDAFSKNGNLTIVPKPDPTVPIG 281

  Fly   273 QRRGLSDKDVSKLNEMYEQDCSEDYLLN 300
            ||.|||..||||:|.:|:.|...:.|.|
 Frog   282 QRDGLSILDVSKINRLYQCDVCSNLLSN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 90/195 (46%)
ZnMc_astacin_like 110..289 CDD:239807 86/183 (47%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 87/185 (47%)
CUB 304..412 CDD:238001 2/6 (33%)
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.