DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and mep1ba

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:235 Identity:98/235 - (41%)
Similarity:136/235 - (57%) Gaps:13/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SDTNIWE-----HCGLFEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAF 131
            :|.:|:|     ...|.||||::.....||.:|.|:..|| ..||:::| .....|...||||||
Zfish    36 TDLDIFEINEVAGLDLVEGDILIEEGESRNTILGEQYRWP-TTVPYFLD-NSLEINAKGVILKAF 98

  Fly   132 KEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVG-RRSGGQVLNLNTPKCVTHGVVVHELLHA 195
            ::|..:|||.|:|:.....:..:.||  |||:|.|| |:.|.|.|::.: .|.:.|.|.||.|||
Zfish    99 EQYRLKTCIDFKPWNGESNYIFVFKG--SGCYSKVGNRQMGKQELSIGS-NCDSLGTVEHEFLHA 160

  Fly   196 LGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKA 260
            ||.:|:||.::||:||.|.|:.|.||..||||.|..|..::.||.|||.||||||..:|:|..:.
Zfish   161 LGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGVPYDYSSVMHYSKTSFNKGSEP 225

  Fly   261 TIEPLDP--YASLGQRRGLSDKDVSKLNEMYEQDCSEDYL 298
            ||....|  ...:|||...||.|:.|||.:|....|..:|
Zfish   226 TIVTKIPEFLNVIGQRMEFSDNDLLKLNRLYNCTTSSTFL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 84/193 (44%)
ZnMc_astacin_like 110..289 CDD:239807 81/181 (45%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 96/226 (42%)
Astacin 72..260 CDD:279708 84/192 (44%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4243
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 1 0.900 - - OOG6_108702
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.