DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and LOC100003133

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_001342763.2 Gene:LOC100003133 / 100003133 -ID:- Length:276 Species:Danio rerio


Alignment Length:260 Identity:88/260 - (33%)
Similarity:131/260 - (50%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RRHNSPAFNFWTEDSDTN---------IWEHCGLF--------EGDIMLHRELLRNGLLNERLTW 105
            ||..|     ::||.:.|         :.::.|:|        ||||.:.....:|......| |
Zfish    29 RRQRS-----YSEDIEENQTAMDRIIDVNDYQGVFSVDGTNLREGDIAVSGRSQKNCFARSCL-W 87

  Fly   106 PEAA-----VPF-----YIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYS 160
            .::.     :.:     |.|....|..:.|.:::      ..||:||.| ....:.:|.|:.. :
Zfish    88 TKSVDGNVYIAYSLSHAYDDADVKNIKEGMELIE------QDTCVRFVP-RTHQRDYLDIQPK-T 144

  Fly   161 GCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHN 225
            ||||.:|.|.|.|.::|.:|.|...||.||||:|||||.|:||..:||:||.|.|.||......|
Zfish   145 GCWSYLGARGGRQTISLQSPDCTGSGVTVHELMHALGFVHEQSRADRDKYVTIMWSNIWKDRLRN 209

  Fly   226 FNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPY-ASLGQRRGLSDKDVSKLNEMY 289
            |.|: :|:  |....|||.||||:...|||::|:.||.|...: ..:|||.|.||.|:.|:|::|
Zfish   210 FEKF-KTN--NLDTPYDYSSVMHFGKYAFSEDGEPTIVPKRNWNVKIGQRLGPSDLDIMKINKLY 271

  Fly   290  289
            Zfish   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 74/197 (38%)
ZnMc_astacin_like 110..289 CDD:239807 72/184 (39%)
LOC100003133XP_001342763.2 ZnMc_hatching_enzyme 92..273 CDD:239810 73/191 (38%)
Astacin 97..274 CDD:279708 73/186 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.