powered by:
Protein Alignment Ing3 and YNG2
DIOPT Version :9
Sequence 1: | NP_573316.1 |
Gene: | Ing3 / 32853 |
FlyBaseID: | FBgn0030945 |
Length: | 686 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011958.1 |
Gene: | YNG2 / 856490 |
SGDID: | S000001132 |
Length: | 282 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 74 |
Identity: | 36/74 - (48%) |
Similarity: | 46/74 - (62%) |
Gaps: | 8/74 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 607 GENGLVVEQTNEGEWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYC 671
|:|| ...||.| ::..||.|.:||:|:|||||...|.||||||.||.:.:||||.|||
Yeast 209 GQNG---SPENEEE-----DKTLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYC 265
Fly 672 PKCTASMRR 680
|:|...|.:
Yeast 266 PECKIEMEK 274
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ing3 | NP_573316.1 |
ING |
3..103 |
CDD:289749 |
|
PHD_ING3 |
630..674 |
CDD:277060 |
28/43 (65%) |
YNG2 | NP_011958.1 |
TNG2 |
1..272 |
CDD:227367 |
35/70 (50%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345209 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5034 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
106 |
1.000 |
Inparanoid score |
I1409 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000296 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10333 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2364 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X195 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.920 |
|
Return to query results.
Submit another query.