DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and PHO23

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_014302.3 Gene:PHO23 / 855626 SGDID:S000005041 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:58/242 - (23%)
Similarity:84/242 - (34%) Gaps:91/242 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 AGGSSTGSHHSHHSQSHHGGHGHGHGHGHGHGHGHGHHSSSGHGGGHSSHH-------------Q 497
            |.....|.|:|  :.:|.........:     :|...|.|..|.|.:::..             :
Yeast   163 AANRRQGEHYS--ASTHQQDDSKNDAN-----YGGSRHESQDHTGNNTNSRKRANAANTNNADPE 220

  Fly   498 EKKQKKKLTTALTLPTVQPTAGSSSGNSIGSSSSISLESVNKLTTSAALAAASATTTYMSVGGQA 562
            .||:|:::.|....|:...||.:.:...||:|           |.|..:::.             
Yeast   221 TKKRKRRVATTAVSPSTISTATAVNNGRIGTS-----------TASRGVSSV------------- 261

  Fly   563 LLAMTPGGGGGGNLAESSAEGVPAGMIAMNLPTTTVTPGSSLTIGENGLVVEQTNEGEWSYDPNE 627
                     |..|.:..|.                                .:||      |..|
Yeast   262 ---------GNSNNSRISR--------------------------------PKTN------DYGE 279

  Fly   628 PRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKC 674
            |.||.||||:||:||.||...|..||||.||:|:...|||||||..|
Yeast   280 PLYCYCNQVAYGEMVGCDGADCELEWFHLPCIGLETLPKGKWYCDDC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 27/43 (63%)
PHO23NP_014302.3 TNG2 5..330 CDD:227367 58/242 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm46516
orthoMCL 1 0.900 - - OOG6_107420
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.