DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and YNG1

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_014707.1 Gene:YNG1 / 854230 SGDID:S000005590 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:67/202 - (33%)
Similarity:86/202 - (42%) Gaps:71/202 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 HQEKKQKKKLTTALTLPTVQPTAGSSSGNSIGSSSSISLESV-NKLTTSAALAAASATTTYMSVG 559
            |..|:.||:|       .:|        .|:..:.:.|||:: :|||                  
Yeast    73 HFLKQHKKEL-------EIQ--------KSVTKNFNSSLENIKSKLT------------------ 104

  Fly   560 GQALLAMTPGGGGGGNLAESSAEGVPAGMIAMNLPTT-------TVTPGSSLTIGEN-GLVVEQT 616
                            |.|..|...|..::.:||...       ::|   |.|||.| |.|.|..
Yeast   105 ----------------LEEPGAYKEPKLLLKINLKKAKSRERKESIT---SPTIGINQGDVTEGN 150

  Fly   617 NEGEWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPK-C--TASM 678
            |.       .|..||.|..||||.||||||.|||:|||||.|||:.|.|||||||.| |  .|:.
Yeast   151 NN-------QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQ 208

  Fly   679 RRRGNRK 685
            |.:..|:
Yeast   209 RSKSKRQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 33/44 (75%)
YNG1NP_014707.1 TNG2 1..206 CDD:227367 64/191 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm46939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.