DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and ING2

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_974025.1 Gene:ING2 / 841881 AraportID:AT1G54390 Length:328 Species:Arabidopsis thaliana


Alignment Length:167 Identity:41/167 - (24%)
Similarity:69/167 - (41%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLEDYLEMIEHLPQELRDRFTEMRELDLAVQNNMDSLDKKAHMFFKQC--------KRDELQHE 58
            :|::||||.....|.||:.....:||||    ....||..:.....|.|        |:....|.
plant     8 VYVDDYLEYASTFPAELQRLLNTVRELD----ERSQSLINQTRQQTKYCLGLASQSSKKGNGNHY 68

  Fly    59 S---MDTE--FHSLRGEYFKVMEDA----DEKVAIATQIHELVERYLRRLDSELFKFKCELEADN 114
            :   :|.|  ...:|.|.....|:|    .|||.:|.|.::|::.:::|||.:|          |
plant    69 NNGGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDL----------N 123

  Fly   115 NGITEILERRSLELDGNSTAATALLLSMNQKENRYYG 151
            |...::.:...:..|..|......::...:|...:||
plant   124 NFAEDLKQEGKIPPDEPSVLPPLPIVPKAEKRKSFYG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749 33/116 (28%)
PHD_ING3 630..674 CDD:277060
ING2NP_974025.1 ING 9..122 CDD:289749 33/116 (28%)
PHD_SF 208..>226 CDD:304600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3950
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.