DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and TAF3

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_114129.1 Gene:TAF3 / 83860 HGNCID:17303 Length:929 Species:Homo sapiens


Alignment Length:177 Identity:50/177 - (28%)
Similarity:74/177 - (41%) Gaps:51/177 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 TVQPTAGSSSGNSIGSSSSISLESVNKLTTSAALAAASATTTYMSVGGQALLAMTPGGGGGGNLA 577
            |..|....:.|..:.|.:.:.|         ..||.|:|        |.|||. :||....|..|
Human   794 TPPPAPAPAPGPMLVSPAPVPL---------PLLAQAAA--------GPALLP-SPGPAASGASA 840

  Fly   578 ESSAEGVPAGMIAMNLPTTTVTPGSSLTIGENGLVVEQTNEGEWSYDPNEPRYCT-CNQVSYGD- 640
            ::....|         .|.||   |:..|.:           ||.   |:...|. ||:...|. 
Human   841 KAPVRSV---------VTETV---STYVIRD-----------EWG---NQIWICPGCNKPDDGSP 879

  Fly   641 MVACDNDACPYEWFHYPCVGI-TQPPKG-KWYCPKCTASMRRRGNRK 685
            |:.||:  |. :|:|:||||| |.||:. :|:||||....:.:.::|
Human   880 MIGCDD--CD-DWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKK 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 21/47 (45%)
TAF3NP_114129.1 BTP 5..79 CDD:128846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..197
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..358
PTZ00449 <229..388 CDD:185628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..578
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..658
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 692..748
PRK12323 <777..>847 CDD:237057 17/70 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..807 3/12 (25%)
PHD_TAF3 867..912 CDD:276997 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.