DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and ING1

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_566742.1 Gene:ING1 / 821986 AraportID:AT3G24010 Length:234 Species:Arabidopsis thaliana


Alignment Length:135 Identity:54/135 - (40%)
Similarity:70/135 - (51%) Gaps:22/135 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 ASATTTYMSVGGQALLAMTPGGGGGGNLAESSAEGVPAGMIAMNLPTTTVTPGSSLTIGENGLVV 613
            |:|.|..:...|:|           ||..|....|.....:|....|...:.|.:.:..:..|.|
plant   120 AAAATLELENNGKA-----------GNAGEGGRGGRKKTRLATAASTAAASTGMTSSNMDLDLPV 173

  Fly   614 EQTNEGEWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKC-TAS 677
                      |||||.||.|||||:|:||||||:||..||||:.|||:.:.||||||||:| |..
plant   174 ----------DPNEPTYCICNQVSFGEMVACDNNACKIEWFHFGCVGLKEQPKGKWYCPECATVK 228

  Fly   678 MRRRG 682
            ..|:|
plant   229 KSRKG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 31/43 (72%)
ING1NP_566742.1 ING_plant 11..107 CDD:341097
PHD_Yng1p_like 180..225 CDD:277062 31/44 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1733
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.