DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and Ing2

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_075992.2 Gene:Ing2 / 69260 MGIID:1916510 Length:281 Species:Mus musculus


Alignment Length:66 Identity:41/66 - (62%)
Similarity:48/66 - (72%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 EWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKCTASMRRRGNR 684
            |::.|||||.||.|||||||:|:.|||:.||.||||:.||.:|..||||||||||     |..|.
Mouse   205 EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKC-----RGDNE 264

  Fly   685 K 685
            |
Mouse   265 K 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 30/43 (70%)
Ing2NP_075992.2 ING 28..122 CDD:289749
TNG2 31..260 CDD:227367 38/59 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..204
PHD_ING2 214..262 CDD:277153 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 2/5 (40%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 265..281 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.