DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and ing1

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001035446.1 Gene:ing1 / 678608 ZFINID:ZDB-GENE-060421-4388 Length:309 Species:Danio rerio


Alignment Length:179 Identity:63/179 - (35%)
Similarity:81/179 - (45%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 SGNSIGSSSSISLESVNKLTTSAALAAASATT-------TYMSV---GGQALLAMTPGGGG--GG 574
            |..|:||:.| ::.:....|.|..|.:||..|       |..||   ||:.......|...  ..
Zfish   124 SSVSVGSTPS-AITTTAMTTISDILLSASKLTANRRREETPSSVDKSGGKRSRRQKNGSENRENS 187

  Fly   575 NLAESSAEGVPAGMIAMNLPTTTVTPGSSLTIGENGLVVEQTNE---GEWSYDPNEPRYCTCNQV 636
            |.:....|.|.:|......|..:.|........::    :|..|   .:...|||||.||.|.||
Zfish   188 NYSLEHIEDVSSGTPKEKKPKASATSSKKKKRSKS----KQDREPSPTDLPIDPNEPTYCLCEQV 248

  Fly   637 SYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKCTASMRRRGNRK 685
            |||:|:.||||.|..||||:.||.:...||||||||||     |..|.|
Zfish   249 SYGEMIGCDNDECTIEWFHFSCVDLHHKPKGKWYCPKC-----RGDNEK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 28/43 (65%)
ing1NP_001035446.1 ING 17..111 CDD:289749
TNG2 18..287 CDD:227367 60/172 (35%)
PHD_ING1_2 242..286 CDD:277059 28/43 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.