DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ing3 and ing2

DIOPT Version :9

Sequence 1:	NP_573316.1	Gene:	Ing3 / 32853	FlyBaseID:	FBgn0030945	Length:	686	Species:	Drosophila melanogaster
Sequence 2:	NP_001017044.1	Gene:	ing2 / 549798	XenbaseID:	XB-GENE-951849	Length:	279	Species:	Xenopus tropicalis

Alignment Length:	64	Identity:	38/64 - (59%)
Similarity:	46/64 - (71%)	Gaps:	0/64 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   621 WSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKCTASMRRRGNR 684
            ::.|||||.||.|||||||:|:.||||.|..||||:.|||:|..||||||||.|.....:..|:
Frog   204 FAIDPNEPTYCLCNQVSYGEMIGCDNDECTIEWFHFSCVGLTYKPKGKWYCPDCRGDNEKTMNK 267

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ing3	NP_573316.1	ING	3..103	CDD:289749
Ing3	NP_573316.1	PHD_ING3	630..674	CDD:277060	31/43 (72%)
ing2	NP_001017044.1	ING	31..118	CDD:355795
ing2	NP_001017044.1	PHD_ING1_2	213..257	CDD:277059	31/43 (72%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1434088at2759
OrthoFinder	1	1.000	-	-		FOG0000296
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X195
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.920