powered by:
Protein Alignment Ing3 and ing4
DIOPT Version :9
Sequence 1: | NP_573316.1 |
Gene: | Ing3 / 32853 |
FlyBaseID: | FBgn0030945 |
Length: | 686 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001018304.1 |
Gene: | ing4 / 322113 |
ZFINID: | ZDB-GENE-050522-47 |
Length: | 250 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 34/58 - (58%) |
Similarity: | 45/58 - (77%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 624 DPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKCTASMRRR 681
|||||.||.|:|||||:|:.|||..|..||||:.|||:|..|:||||||:|:...:::
Zfish 193 DPNEPTYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYCPRCSQERKKK 250
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1434088at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000296 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2364 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X195 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.850 |
|
Return to query results.
Submit another query.