| Sequence 1: | NP_573316.1 | Gene: | Ing3 / 32853 | FlyBaseID: | FBgn0030945 | Length: | 686 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036049.2 | Gene: | Ing1 / 26356 | MGIID: | 1349481 | Length: | 279 | Species: | Mus musculus |
| Alignment Length: | 51 | Identity: | 38/51 - (74%) |
|---|---|---|---|
| Similarity: | 42/51 - (82%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 624 DPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKC 674 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ing3 | NP_573316.1 | ING | 3..103 | CDD:463768 | |
| PHD_ING3 | 630..674 | CDD:277060 | 31/43 (72%) | ||
| Ing1 | NP_036049.2 | ING_ING1 | 20..107 | CDD:341093 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 115..206 | 38/51 (75%) | |||
| PHD_ING1_2 | 212..256 | CDD:277059 | 31/43 (72%) | ||
| PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 | 262..279 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||