DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ing3 and Taf3

DIOPT Version :9

Sequence 1:	NP_573316.1	Gene:	Ing3 / 32853	FlyBaseID:	FBgn0030945	Length:	686	Species:	Drosophila melanogaster
Sequence 2:	NP_082024.2	Gene:	Taf3 / 209361	MGIID:	2388097	Length:	932	Species:	Mus musculus

Alignment Length:	106	Identity:	32/106 - (30%)
Similarity:	50/106 - (47%)	Gaps:	20/106 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   594 PTTTVTPGSSLT-IGE-----NGLVVEQTN----EGEWSYDPNEPRYCT-CNQVSYGD-MVACDN 646
            |....:|..:|: ||.     ..:|.|..:    ..||.   |:...|. ||:...|. |:.||:
Mouse   826 PALMPSPAPALSGIGSAKAPVRSVVTETVSTYVIRDEWG---NQIWICPGCNKPDDGSPMIGCDD 887

  Fly   647 DACPYEWFHYPCVGI--TQPPKGKWYCPKCTASMRRRGNRK 685
              |. :|:|:|||||  ..|.:.:|:||||...:::....|
Mouse   888 --CD-DWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKHK 925

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ing3	NP_573316.1	ING	3..103	CDD:289749
Ing3	NP_573316.1	PHD_ING3	630..674	CDD:277060	19/47 (40%)
Taf3	NP_082024.2	BTP	5..79	CDD:128846
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	130..201
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	213..347
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	403..465
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	480..579
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	607..657
		RSB_motif	607..>656	CDD:292910
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	681..746
		PHD_TAF3	869..914	CDD:276997	19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5034
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900