DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and athp-3

DIOPT Version :10

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_503022.1 Gene:athp-3 / 178479 WormBaseID:WBGene00013799 Length:286 Species:Caenorhabditis elegans


Alignment Length:77 Identity:19/77 - (24%)
Similarity:30/77 - (38%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 GSSLTIGENGLVVEQTNEGEWSYDPNEPRYC-TCNQVSYGDMVACDNDACPYEWFHYPCVGI-TQ 663
            |..|.|.:|  :..:.|:.:   |..:...| .|...|......|..  | .:|.|..|.|| ::
 Worm   217 GRPLKIAKN--MEPEINQKK---DTKQVHVCPICTLASKNGTCLCTK--C-QKWVHLKCTGIRSK 273

  Fly   664 PPKGKWYCPKCT 675
            ....::.|..||
 Worm   274 QWNSQFQCKNCT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:463768
PHD_ING3 630..674 CDD:277060 11/45 (24%)
athp-3NP_503022.1 PHD_TCF19_like 241..284 CDD:276992 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.