DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing3 and LOC101884644

DIOPT Version :9

Sequence 1:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_009297415.1 Gene:LOC101884644 / 101884644 -ID:- Length:555 Species:Danio rerio


Alignment Length:76 Identity:19/76 - (25%)
Similarity:21/76 - (27%) Gaps:25/76 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 SHHSH---HSQSHHGGHGHGHGH--------GHGHGHGHGHHSS--------------SGHGGGH 492
            ||..|   |..||.|...:..||        .|...|...|...              |||...|
Zfish   397 SHSGHLKTHEMSHTGEKPYKCGHCKKRFIRSEHLKVHERIHTGEKPYKCSLCDKRFIRSGHLTVH 461

  Fly   493 SSHHQEKKQKK 503
            ...|..:|..|
Zfish   462 ERIHTGEKPYK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060
LOC101884644XP_009297415.1 C2H2 Zn finger 27..47 CDD:275368
C2H2 Zn finger 55..75 CDD:275368
C2H2 Zn finger 83..103 CDD:275368
COG5048 107..534 CDD:227381 19/76 (25%)
C2H2 Zn finger 111..131 CDD:275368
C2H2 Zn finger 139..159 CDD:275368
C2H2 Zn finger 165..185 CDD:275368
C2H2 Zn finger 193..213 CDD:275368
zf-H2C2_2 205..230 CDD:290200
C2H2 Zn finger 221..241 CDD:275368
zf-H2C2_2 233..258 CDD:290200
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..325 CDD:275368
C2H2 Zn finger 333..353 CDD:275368
zf-H2C2_2 346..370 CDD:290200
C2H2 Zn finger 361..381 CDD:275368
C2H2 Zn finger 389..409 CDD:275368 4/11 (36%)
C2H2 Zn finger 417..437 CDD:275368 4/19 (21%)
C2H2 Zn finger 445..465 CDD:275368 4/19 (21%)
C2H2 Zn finger 473..493 CDD:275368 19/76 (25%)
C2H2 Zn finger 501..521 CDD:275368
C2H2 Zn finger 529..549 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.