powered by:
Protein Alignment wgn and Tnfrsf4
DIOPT Version :9
Sequence 1: | NP_728186.1 |
Gene: | wgn / 32849 |
FlyBaseID: | FBgn0030941 |
Length: | 343 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_037181.1 |
Gene: | Tnfrsf4 / 25572 |
RGDID: | 3920 |
Length: | 271 |
Species: | Rattus norvegicus |
Alignment Length: | 41 |
Identity: | 14/41 - (34%) |
Similarity: | 17/41 - (41%) |
Gaps: | 3/41 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 PCAPQHWWDSQRDRCTPCTRC--QGEMIPLRPCQLHTDTIC 137
||.|.|:.......|.|.|.| .|:.| ..|.....||:|
Rat 124 PCPPGHFSPGSNQACKPWTNCTLSGKQI-RHPASNSLDTVC 163
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.