DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wgn and Tnfrsf4

DIOPT Version :9

Sequence 1:NP_728186.1 Gene:wgn / 32849 FlyBaseID:FBgn0030941 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_006538787.3 Gene:Tnfrsf4 / 22163 MGIID:104512 Length:352 Species:Mus musculus


Alignment Length:41 Identity:12/41 - (29%)
Similarity:15/41 - (36%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PCAPQHWWDSQRDRCTPCTRC--QGEMIPLRPCQLHTDTIC 137
            ||.|.|:.......|.|.|.|  .|:. ...|.....|.:|
Mouse   213 PCPPGHFSPGNNQACKPWTNCTLSGKQ-TRHPASDSLDAVC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgnNP_728186.1 TNFR_c6 100..137 CDD:278449 10/38 (26%)
Tnfrsf4XP_006538787.3 TNFRSF4 113..256 CDD:276911 12/41 (29%)
CRD2 151..191 CDD:276911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.