| Sequence 1: | NP_001259687.1 | Gene: | Bx / 32846 | FlyBaseID: | FBgn0265598 | Length: | 424 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005442.2 | Gene: | PDLIM7 / 9260 | HGNCID: | 22958 | Length: | 457 | Species: | Homo sapiens |
| Alignment Length: | 208 | Identity: | 45/208 - (21%) |
|---|---|---|---|
| Similarity: | 73/208 - (35%) | Gaps: | 53/208 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 PNPNGNGNVVNVVNSGGAGGGNNGNGNV------------QSIAAAANNNNNNNNNGSQLCAGCG 96
Fly 97 KHIQD------------------RY--------------LLRALDMLWHEDCLKCGCCDCRLGEV 129
Fly 130 GSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVG 194
Fly 195 DRFYLCENKILCE 207 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Bx | NP_001259687.1 | LIM1_LMO1_LMO3 | 92..146 | CDD:188774 | 17/85 (20%) |
| LIM2_dLMO | 156..210 | CDD:188776 | 15/52 (29%) | ||
| PDLIM7 | NP_005442.2 | PDZ_signaling | 5..79 | CDD:238492 | |
| Atrophin-1 | <81..254 | CDD:331285 | 1/1 (100%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 82..142 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..226 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 239..258 | 2/5 (40%) | |||
| LIM1_Enigma | 282..333 | CDD:188836 | 5/54 (9%) | ||
| LIM2_Enigma | 341..392 | CDD:188840 | 11/52 (21%) | ||
| LIM3_Enigma | 400..454 | CDD:188842 | 15/52 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||