DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and RGA2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_010667.1 Gene:RGA2 / 851985 SGDID:S000002787 Length:1009 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:31/130 - (23%)
Similarity:51/130 - (39%) Gaps:9/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF 150
            |:.|.||..|.|.|....:.......||:.|..|..||.:|......|......::|       :
Yeast     7 NDQSSLCVRCNKSIASSQVYELESKKWHDQCFTCYKCDKKLNADSDFLVLDIGTLIC-------Y 64

  Fly   151 GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLV 215
            ..:..|..|...|....:::.:....|...||.|.:|::|  :.:..|....:.||..|..|:|:
Yeast    65 DCSDKCTNCGDKIDDTAIILPSSNEAYCSNCFRCCRCSNR--IKNLKYAKTKRGLCCMDCHEKLL 127

  Fly   216  215
            Yeast   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/53 (25%)
LIM2_dLMO 156..210 CDD:188776 12/53 (23%)
RGA2NP_010667.1 LIM1_Rga 13..67 CDD:188780 13/60 (22%)
LIM2_Rga 70..123 CDD:188781 13/54 (24%)
RhoGAP 815..1002 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.