DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Tgfb1i1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006230411.1 Gene:Tgfb1i1 / 84574 RGDID:620173 Length:473 Species:Rattus norvegicus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:70/147 - (47%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNT 153
            |..|..|.:.|:.: ::.||...||.:...|..|....||.|  .:.:.....|:||:|:||...
  Rat   296 SPRCGFCNQPIRHK-MVTALGTHWHPEHFCCVSCGEPFGEEG--FHEREGRPYCRRDFLQLFAPR 357

  Fly   154 GYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCE-YDYEERLVFA 217
              |..|..  |..:..:.|.:.::|.:||.|::|...|. |..|:..|.:.||| :.:.:|....
  Rat   358 --CQGCQG--PILDNYISALSALWHPDCFVCRECLAPFS-GGSFFEHEGRPLCENHFHAQRGSLC 417

  Fly   218 SMANHPMLKRHVSSLGQ 234
            :....|:..|.||:||:
  Rat   418 ATCGLPVTGRCVSALGR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 14/53 (26%)
LIM2_dLMO 156..210 CDD:188776 16/54 (30%)
Tgfb1i1XP_006230411.1 Paxillin <69..>118 CDD:281527
LIM1_Paxillin_like 240..292 CDD:259830
LIM2_Paxillin_like 299..350 CDD:188723 14/53 (26%)
LIM3_Paxillin 358..410 CDD:188793 16/54 (30%)
LIM4_Leupaxin 417..468 CDD:188796 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.