DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and DAR6

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_201463.1 Gene:DAR6 / 836794 AraportID:AT5G66620 Length:644 Species:Arabidopsis thaliana


Alignment Length:318 Identity:63/318 - (19%)
Similarity:101/318 - (31%) Gaps:93/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRL-------------GEVGSTLYTKG 137
            |....||.||...::....:..|.:|||..|..|..|...:             |:...:.|.: 
plant   280 NPPPSLCGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPIAIHDIENHVSNSRGKFHKSCYER- 343

  Fly   138 NLMLCKRDYLRLFGN----------------TGYCAACSKVIP-AFEMVMRARTNVYHLECF--- 182
            ...:||...::.:.|                |..|.:|.::.| ....||.|......|||.   
plant   344 YCYVCKEKKMKTYNNHPFWEERYCPVHEADGTPKCCSCERLEPRESNYVMLADGRWLCLECMNSA 408

  Fly   183 -----ACQQCNHRFCVGD-------------RFYLCENKIL--------CEYDYE---------E 212
                 .||..:  |.:.|             .|.|.|.:.|        .:|.||         |
plant   409 VMDSDECQPLH--FDMRDFFEGLNMKIEKEFPFLLVEKQALNKAEKEEKIDYQYEVVTRGICLSE 471

  Fly   213 RLVFASMANHPMLKRHVSSLGQG--SPTGAAGAQNTAGGLLGGGPG--GGNVNGVGMVNGPRTPG 273
            ..:..|::..|:...:...:|..  |.......:.||..:|.|.|.  .|.:....|::......
plant   472 EQIVDSVSQRPVRGPNNKLVGMATESQKVTRECEVTAILILYGLPRLLTGYILAHEMMHAYLRLN 536

  Fly   274 DHNNNNN---------------GPQTPTGGGSPFAAAAAAAAAAAHMKNQLGASSXNK 316
            .|.|.||               ..||   ..:..|.|.|:::|::..:....||:..|
plant   537 GHRNLNNILEEGICQVLGHLWLDSQT---YATADATADASSSASSSSRTPPAASASKK 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 14/66 (21%)
LIM2_dLMO 156..210 CDD:188776 18/83 (22%)
DAR6NP_201463.1 LIM_DA1 286..341 CDD:188782 11/54 (20%)
DUF3633 428..642 CDD:289113 32/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.