DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AT4G36860

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001328324.1 Gene:AT4G36860 / 829839 AraportID:AT4G36860 Length:577 Species:Arabidopsis thaliana


Alignment Length:103 Identity:23/103 - (22%)
Similarity:32/103 - (31%) Gaps:35/103 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDY-LRLFGNT 153
            ::|.||...|.....|..:..:||.:|..|..||..:                 .|| ..:.||.
plant   212 RICVGCQAEIGHGRFLSCMGGVWHPECFCCNACDKPI-----------------IDYEFSMSGNR 259

  Fly   154 GYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRF 191
            .|...|.|             ..:|.:|..|    |.|
plant   260 PYHKLCYK-------------EQHHPKCDVC----HNF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 11/53 (21%)
LIM2_dLMO 156..210 CDD:188776 7/36 (19%)
AT4G36860NP_001328324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.