Sequence 1: | NP_001259687.1 | Gene: | Bx / 32846 | FlyBaseID: | FBgn0265598 | Length: | 424 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_180413.2 | Gene: | AT2G28460 / 817394 | AraportID: | AT2G28460 | Length: | 720 | Species: | Arabidopsis thaliana |
Alignment Length: | 233 | Identity: | 42/233 - (18%) |
---|---|---|---|
Similarity: | 68/233 - (29%) | Gaps: | 97/233 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 NGNVQSIAAAANNNNNNNNNG-----SQLCAGCGKHIQ--DRYLLRALDMLWHEDCL-------- 117
Fly 118 ----------------------KCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTG------ 154
Fly 155 -YCAACSKVI-------PAF------EMVMRARTNVYHLECFACQQCNHRFCVGDRFY--LCENK 203
Fly 204 ILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAA 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bx | NP_001259687.1 | LIM1_LMO1_LMO3 | 92..146 | CDD:188774 | 15/85 (18%) |
LIM2_dLMO | 156..210 | CDD:188776 | 15/68 (22%) | ||
AT2G28460 | NP_180413.2 | C1_3 | 243..271 | CDD:284959 | |
C1_3 | 298..327 | CDD:284959 | |||
C1_2 | 353..384 | CDD:281148 | |||
C1_3 | 442..471 | CDD:284959 | 7/28 (25%) | ||
C1_2 | 610..639 | CDD:281148 | 42/233 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |