DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and AT2G28460

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_180413.2 Gene:AT2G28460 / 817394 AraportID:AT2G28460 Length:720 Species:Arabidopsis thaliana


Alignment Length:233 Identity:42/233 - (18%)
Similarity:68/233 - (29%) Gaps:97/233 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGNVQSIAAAANNNNNNNNNG-----SQLCAGCGKHIQ--DRYLLRALDMLWHEDCL-------- 117
            :|.:|..:...::...:.|.|     ::.|..|.:.|.  :.|.....|.:.||:|.        
plant   415 DGIIQHFSHQQHHMKLDENTGRDYDENKECEACIRPIYFGNFYSCLECDFILHEECANLSRKIHH 479

  Fly   118 ----------------------KCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTG------ 154
                                  ||..|      :|          |||..:....|..|      
plant   480 PIHPHLLNLIGGFDGVINYYNDKCSAC------IG----------LCKGGFFYECGKQGCKFMLH 528

  Fly   155 -YCAACSKVI-------PAF------EMVMRARTNVYHLECFACQQCNHRFCVGDRFY--LCENK 203
             .||..|:.:       |.|      |.: |........|.|.|.:|:...|    ||  :...|
plant   529 VQCATTSEPLVHESHRHPLFLTSKPGEKI-RCSVCKDSEETFNCIECDFALC----FYCAILPQK 588

  Fly   204 ILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAA 241
            :..::|                 :|..:|..|..||.:
plant   589 VRYKHD-----------------KHTLTLSYGKETGTS 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/85 (18%)
LIM2_dLMO 156..210 CDD:188776 15/68 (22%)
AT2G28460NP_180413.2 C1_3 243..271 CDD:284959
C1_3 298..327 CDD:284959
C1_2 353..384 CDD:281148
C1_3 442..471 CDD:284959 7/28 (25%)
C1_2 610..639 CDD:281148 42/233 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.