DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lpp

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_012818600.1 Gene:lpp / 779875 XenbaseID:XB-GENE-951633 Length:614 Species:Xenopus tropicalis


Alignment Length:279 Identity:64/279 - (22%)
Similarity:97/279 - (34%) Gaps:84/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNNGPNPNGNGNVVNVVNSGG-----------AGG 63
            ||| .|.|...|.:.|....||..|.  ||:        ||:.|.....||           |.|
 Frog   289 EPG-YGYSQGNQSKYQDPYYQSVQGY--GGR--------NGSEVPYTQQGGWKPEPAYSPIPAVG 342

  Fly    64 -----GNNGNGNVQS-------------------------IAAAANNNNNN-------------N 85
                 |....|:.|.                         :|.|::....:             .
 Frog   343 QQPAVGQQPAGSYQPPNTKKTYITDPPYIPPPPPQPKGPYLAQASSLRPEDELERLTKKMLYDME 407

  Fly    86 NNGSQ----LCAGCGKHIQDRYL-LRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRD 145
            |..|:    .|:.||:::..... ..|:|.::|.:|..|..|:.:|.  |...|.......|:..
 Frog   408 NPPSEEYFGRCSRCGENVVGEGTGCTAMDQVFHVECFTCMTCNSKLR--GQPFYAVEKKAFCEPC 470

  Fly   146 YLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYL-CENKILCEYD 209
            |:|....   |:.|:|  |..|.::||....||..||.|..| .|...|..|.: ...:|.|..|
 Frog   471 YIRTLEK---CSVCAK--PIMERILRATGKAYHPHCFTCVVC-FRSLDGIPFTVDASGQIHCIED 529

  Fly   210 YEERLVFA---SMANHPML 225
            :.::  ||   |:...|::
 Frog   530 FHKK--FAPRCSVCKEPIM 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/54 (24%)
LIM2_dLMO 156..210 CDD:188776 18/54 (33%)
lppXP_012818600.1 PHA03247 <4..358 CDD:223021 22/79 (28%)
PRK10263 <171..>341 CDD:236669 17/62 (27%)
LIM1_TRIP6 418..471 CDD:188736 13/54 (24%)
LIM 478..537 CDD:413332 21/63 (33%)
LIM3_TRIP6 538..603 CDD:188820 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.