DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and ZYX

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001010972.1 Gene:ZYX / 7791 HGNCID:13200 Length:572 Species:Homo sapiens


Alignment Length:252 Identity:58/252 - (23%)
Similarity:84/252 - (33%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKTEPGLVGLSSNQQQQQQQQSQQSNAGMNS------------------GGQNNGPNPNGNGNVV 53
            :|..||..|.|.:|..|:....:..:||..|                  ..|:..|.|..|   .
Human   278 SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQN---Q 339

  Fly    54 NVVNSGGAGGG------NNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHI-QDRYLLRALDML 111
            |.|.|.||.|.      .......|.:.....:....|...::||..|.:.: :.:..:|||..|
Human   340 NQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQL 404

  Fly   112 WHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNV 176
            :|..|..|..|..:|  .|...|:......|:..|......   |..|.:  |..:.::||....
Human   405 FHIACFTCHQCAQQL--QGQQFYSLEGAPYCEGCYTDTLEK---CNTCGE--PITDRMLRATGKA 462

  Fly   177 YHLECFAC--------------QQCNHRFCVGD-------RFYLCENKILCEYDYEE 212
            ||..||.|              .|.|...||.|       |..:|...|:.|...:|
Human   463 YHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 14/54 (26%)
LIM2_dLMO 156..210 CDD:188776 19/74 (26%)
ZYXNP_001010972.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..351 20/75 (27%)
PAT1 <201..>365 CDD:330585 20/89 (22%)
LIM1_Zyxin 351..437 CDD:188735 17/87 (20%)
LIM 444..503 CDD:295319 15/60 (25%)
LIM3_Zyxin 504..570 CDD:188819 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.