DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and TRIP6

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_003293.2 Gene:TRIP6 / 7205 HGNCID:12311 Length:476 Species:Homo sapiens


Alignment Length:216 Identity:53/216 - (24%)
Similarity:77/216 - (35%) Gaps:45/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PNPNGNGNVVNVVNSGGAG-GGNNG---------NGNVQSIAAAANNNNNNNNNGSQL--CAGCG 96
            |.|........|....|.| ||.:|         ...:..:.....::.|:..:|...  |.|||
Human   219 PGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCG 283

  Fly    97 KH-IQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACS 160
            :. :.|...:.|||.::|..|..|..|..:|.  |...|.......|:..|:.....   ||.||
Human   284 EDVVGDGAGVVALDRVFHVGCFVCSTCRAQLR--GQHFYAVERRAYCEGCYVATLEK---CATCS 343

  Fly   161 KVIPAFEMVMRARTNVYHLECFACQQCNHR---------------FCVGD-------RFYLCENK 203
            :  |..:.::||....||..||.|..| ||               .|:.|       |..:|...
Human   344 Q--PILDRILRAMGKAYHPGCFTCVVC-HRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGA 405

  Fly   204 ILCEYDYEE--RLVFASMANH 222
            |:.|...||  |:|....:.|
Human   406 IMPEPGQEETVRIVALDRSFH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/54 (30%)
LIM2_dLMO 156..210 CDD:188776 21/75 (28%)
TRIP6NP_003293.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93
Atrophin-1 <8..251 CDD:331285 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..253 8/33 (24%)
LIM1_TRIP6 279..332 CDD:188736 16/54 (30%)
LIM 339..398 CDD:295319 17/61 (28%)
LIM3_Zyxin_like 399..461 CDD:188743 8/28 (29%)
Interaction with MAGI1 and PTPN13. /evidence=ECO:0000269|PubMed:19017743 469..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.