DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Trip6

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001121042.1 Gene:Trip6 / 686323 RGDID:1583180 Length:480 Species:Rattus norvegicus


Alignment Length:227 Identity:56/227 - (24%)
Similarity:82/227 - (36%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AGMNSGGQNNGPNPNGNGNVVNVVNSGGAG--GGNNGNG--------NVQSIAAAANNNNNNNNN 87
            ||..|   :..|.|........|.|..|.|  ||:...|        .::.:.....::.|:..:
  Rat   215 AGYRS---HREPGPGVKEGAAGVHNPAGGGRRGGHEPQGPLSQPPEEELERLTKKLVHDMNHPPS 276

  Fly    88 GSQL--CAGCGKH-IQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRL 149
            |...  |.|||.. :.|...:.|||.::|..|..|..|..:|.  |...|.......|:..|:..
  Rat   277 GEYFGRCGGCGDDVVGDGAGVVALDRVFHTGCFVCSTCRAQLR--GQHFYAVERRAYCESCYVAT 339

  Fly   150 FGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHR---------------FCVGD---- 195
            ...   |:.||:  |..:.::||....||..||.|..| ||               .|:.|    
  Rat   340 LEK---CSTCSE--PILDRILRAMGKAYHPGCFTCVVC-HRGLDGIPFTVDATSQIHCIEDFHRK 398

  Fly   196 ---RFYLCENKILCEYDYEE--RLVFASMANH 222
               |..:|...|:.|...||  |:|....:.|
  Rat   399 FAPRCSVCGGAIMPEPGQEETVRIVALDRSFH 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/54 (30%)
LIM2_dLMO 156..210 CDD:188776 20/75 (27%)
Trip6NP_001121042.1 PHA03247 <3..256 CDD:223021 12/43 (28%)
LIM1_TRIP6 283..336 CDD:188736 16/54 (30%)
LIM 343..402 CDD:413332 16/61 (26%)
LIM3_Zyxin_like 403..465 CDD:188743 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.