DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Isl1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_059035.3 Gene:Isl1 / 64444 RGDID:61957 Length:349 Species:Rattus norvegicus


Alignment Length:148 Identity:60/148 - (40%)
Similarity:81/148 - (54%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLR-ALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTG 154
            ||.|||..|.|:|:|| :.|:.||..||||..|:..|.| ..|.:.:.....|||||:||:|.. 
  Rat    16 LCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDE-SCTCFVRDGKTYCKRDYIRLYGIK- 78

  Fly   155 YCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASM 219
             ||.||......:.|||||:.|||:|||.|..|:.:...||.|.|.|:.:.|.            
  Rat    79 -CAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCR------------ 130

  Fly   220 ANHPMLKRHVSSLGQGSP 237
            |:|.:::|  :|||.|.|
  Rat   131 ADHDVVER--ASLGAGDP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 23/54 (43%)
LIM2_dLMO 156..210 CDD:188776 23/53 (43%)
Isl1NP_059035.3 LIM1_Isl 17..71 CDD:188752 23/54 (43%)
LIM2_Isl 79..133 CDD:188760 24/65 (37%)
HOX 181..237 CDD:197696
LIM-binding domain (LID). /evidence=ECO:0000250 262..291
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.