DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Pdlim5

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006233474.1 Gene:Pdlim5 / 64353 RGDID:621076 Length:624 Species:Rattus norvegicus


Alignment Length:141 Identity:36/141 - (25%)
Similarity:53/141 - (37%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            |..|.:.|... ::.||...||..|..|..|...:.  .:..:.:.....|:.||..|||.  .|
  Rat   507 CGRCQRKILGE-VINALKQTWHVSCFVCVACGKPIR--NNVFHLEDGEPYCETDYYALFGT--IC 566

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMAN 221
            ..|...|.|.:|.:.|..:.:|..||.|..|            ||:.        |...|.|..:
  Rat   567 RGCEFPIEAGDMFLEALGSTWHDTCFVCSVC------------CESL--------EGQTFFSKKD 611

  Fly   222 HPMLKRHVSSL 232
            .|:.|:|..|:
  Rat   612 KPLCKKHAHSV 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 11/53 (21%)
LIM2_dLMO 156..210 CDD:188776 13/53 (25%)
Pdlim5XP_006233474.1 PDZ_signaling 10..82 CDD:238492
DUF4749 214..305 CDD:292558
LIM1_ENH 448..499 CDD:188837
LIM 507..558 CDD:295319 11/53 (21%)
LIM 566..620 CDD:295319 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.