DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and PXN

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_016875215.1 Gene:PXN / 5829 HGNCID:9718 Length:1135 Species:Homo sapiens


Alignment Length:151 Identity:42/151 - (27%)
Similarity:67/151 - (44%) Gaps:9/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRL 149
            :|..|..|..|...|.|: ::.|||..||.:...|..|....|..|  .:.|.....|::||..:
Human   954 HNLFSPRCYYCNGPILDK-VVTALDRTWHPEHFFCAQCGAFFGPEG--FHEKDGKAYCRKDYFDM 1015

  Fly   150 FGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL 214
            |...  |..|::.|  .|..:.|...::|.|||.|::|...| |...|:..:.:..||..|.||.
Human  1016 FAPK--CGGCARAI--LENYISALNTLWHPECFVCRECFTPF-VNGSFFEHDGQPYCEVHYHERR 1075

  Fly   215 -VFASMANHPMLKRHVSSLGQ 234
             ...|....|:..|.::::.:
Human  1076 GSLCSGCQKPITGRCITAMAK 1096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 16/53 (30%)
PXNXP_016875215.1 Paxillin 60..259 CDD:281527
LIM1_Paxillin_like 902..954 CDD:259830 42/151 (28%)
LIM2_Paxillin 961..1012 CDD:188791 15/53 (28%)
LIM3_Paxillin_like 1020..1072 CDD:188724 16/54 (30%)
LIM4_Paxillin 1079..1130 CDD:188795 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.