DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and wtip

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001116750.2 Gene:wtip / 566046 ZFINID:ZDB-GENE-050419-261 Length:648 Species:Danio rerio


Alignment Length:313 Identity:73/313 - (23%)
Similarity:113/313 - (36%) Gaps:104/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TEPGLVGLSSNQ--------QQQQQQQSQQSNAGMN-----SGGQ------------NNGPNPNG 48
            |||.  ||.:|:        .::.|||:.:.|.|.|     :|||            ::||:...
Zfish   351 TEPN--GLHNNRVHLQTFPVLEEPQQQNSEVNIGFNYCKAGAGGQRFKLPYQVTPSRDSGPSQAE 413

  Fly    49 N----------------------GNVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNN------- 84
            .                      |..|..        |....|..|:..|..|..:.|       
Zfish   414 RRLEALTLELEKELEIHMKKEYFGICVKC--------GKGVYGASQACQAMGNLYHTNCFTCCSC 470

  Fly    85 ----------NNNG----------------SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCD 123
                      |.||                ::.|..|| |:....:|:||...:|..|.:|..|.
Zfish   471 GRRLRGKAFYNVNGKVYCEEDFLYSGFQQTAEKCFVCG-HLIMEMILQALGRSYHPGCFRCVICK 534

  Fly   124 CRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSK-VIPA--FEMVMR--ARTNVYHLECFA 183
            ..|..|..|:..:.|: .|.:||..:|...  ||:|:: ::||  .|..:|  :....||::|:.
Zfish   535 EGLDGVPFTVDVENNI-YCVKDYHTVFAPK--CASCNQPILPAQGSEETIRVVSMDKDYHVDCYH 596

  Fly   184 CQQCNHRFC--VGDRFYLCENKILCEYDYEERLVFASMANH--PMLKRHVSSL 232
            |:.|..:..  .|.|.|..|..:||...:..||. ..:|.|  |....||:.|
Zfish   597 CEDCGLQLNDEEGHRCYPLEGHLLCHRCHLHRLK-TPLAPHPPPSYPLHVTEL 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/53 (30%)
LIM2_dLMO 156..210 CDD:188776 18/60 (30%)
wtipNP_001116750.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..291
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..327
LIM1_Ajuba_like 439..492 CDD:188738 10/60 (17%)
LIM2_Ajuba_like 504..556 CDD:188741 16/53 (30%)
LIM3_Ajuba_like 564..625 CDD:188822 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.