DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pxnb

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_021334029.1 Gene:pxnb / 565130 ZFINID:ZDB-GENE-130530-697 Length:1197 Species:Danio rerio


Alignment Length:147 Identity:42/147 - (28%)
Similarity:67/147 - (45%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNT 153
            |..|..|...|.|: ::.|||..||.:...|..|....|..|  .:.|.....|::||..||...
Zfish  1020 SPRCYYCNGPILDK-VVTALDRTWHPEHFFCAQCGAFFGPEG--FHEKDGKAYCRKDYFDLFAPK 1081

  Fly   154 GYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL-VFA 217
              |..|::.|  .|..:.|.::::|.|||.|::|...| |...|:..:.:..||..|..|. ...
Zfish  1082 --CGGCARAI--LENYISALSSLWHPECFVCRECFTPF-VNGSFFEHDGQPYCEVHYHARRGSLC 1141

  Fly   218 SMANHPMLKRHVSSLGQ 234
            |....|:..|.::::|:
Zfish  1142 SGCQKPITGRCITAMGK 1158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 16/53 (30%)
pxnbXP_021334029.1 Paxillin 96..272 CDD:308898
Atrophin-1 <178..684 CDD:331285
LIM1_Paxillin_like 964..1016 CDD:259830
LIM2_Paxillin_like 1023..1074 CDD:188723 15/53 (28%)
LIM3_Paxillin_like 1082..1134 CDD:188724 16/54 (30%)
LIM4_Paxillin 1141..1192 CDD:188795 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.