DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Pdlim5

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006501801.1 Gene:Pdlim5 / 56376 MGIID:1927489 Length:734 Species:Mus musculus


Alignment Length:279 Identity:60/279 - (21%)
Similarity:97/279 - (34%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLVGLSSNQQQQQQQQSQQSNAGMNSG------GQNNGPNPN---------GNGNVVNVVNSGGA 61
            |...||:::..:....|:.|.||:.|.      |..:..:|:         ..|.:.|...|.|.
Mouse   463 GASPLSASEGPESPGSSRPSVAGLRSAAAFKPVGSTSVKSPSWQRPNQAAPSTGRISNNARSSGT 527

  Fly    62 GG--GNNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDC 124
            |.  |.....:..::...|.:......  :.:||.|.:.|:..:|: ||...||.:...|..|..
Mouse   528 GASVGPPQPSDQDTLVQRAEHIPAGKR--TPMCAHCNQVIRGPFLV-ALGKSWHPEEFNCAHCKN 589

  Fly   125 RLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQC-- 187
            .:..:| .:..||.| .|:..|.:.|...  |..|.:.|  ...|:.|....:|:.||.|..|  
Mouse   590 TMAYIG-FVEEKGAL-YCELCYEKFFAPE--CGRCQRKI--LGEVINALKQTWHVSCFVCVACGK 648

  Fly   188 ---NHRFCVGDRFYLCENKIL---------CEYDYE---------------------------ER 213
               |:.|.:.|....||....         ||:..|                           |.
Mouse   649 PIRNNVFHLEDGEPYCETDYYALFGTICRGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEG 713

  Fly   214 LVFASMANHPMLKRHVSSL 232
            ..|.|..:.|:.|:|..|:
Mouse   714 QTFFSKKDKPLCKKHAHSV 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 16/53 (30%)
LIM2_dLMO 156..210 CDD:188776 17/67 (25%)
Pdlim5XP_006501801.1 PDZ_signaling 10..82 CDD:238492
PHA03307 150..>540 CDD:223039 16/76 (21%)
DUF4749 214..315 CDD:374237
LIM1_ENH 558..609 CDD:188837 16/53 (30%)
LIM2_ENH 617..668 CDD:188841 15/52 (29%)
LIM3_ENH 676..730 CDD:188843 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.