DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LMO3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001230542.1 Gene:LMO3 / 55885 HGNCID:6643 Length:167 Species:Homo sapiens


Alignment Length:155 Identity:82/155 - (52%)
Similarity:94/155 - (60%) Gaps:40/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLR-------- 148
            ||||.:.|:|||||:|||..||||||||.||||||||         :|..|...|:.        
Human    13 CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE---------HLKRCGSIYIHAAHTEIGI 68

  Fly   149 -----------------------LFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHR 190
                                   |||.||.||||||:||||||||||:.|||||:|||||.||.|
Human    69 CVTLEWPLPFVIIDFSQQITIAWLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQR 133

  Fly   191 FCVGDRFYLCENKILCEYDYEERLV 215
            |||||:|:|..|.|||:.||||.|:
Human   134 FCVGDKFFLKNNMILCQTDYEEGLM 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 31/53 (58%)
LIM2_dLMO 156..210 CDD:188776 40/53 (75%)
LMO3NP_001230542.1 LIM 13..>49 CDD:295319 27/35 (77%)
LIM2_LMO1_LMO3 99..153 CDD:188775 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm41701
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5205
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.