DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LIMS2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:148 Identity:41/148 - (27%)
Similarity:68/148 - (45%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGN 152
            |..:|..|.:.|:.| ::.||...||.:...|..|:...  :|...|.|..|..|:..|.:|||:
Human   218 GVPICGACRRPIEGR-VVNALGKQWHVEHFVCAKCEKPF--LGHRHYEKKGLAYCETHYNQLFGD 279

  Fly   153 TGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFA 217
            .  |..||.||..  .|:.|....:.:.||:|..||.:..:.::|...:.|.:|:..||:     
Human   280 V--CYNCSHVIEG--DVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVCKRCYEK----- 335

  Fly   218 SMANHPM-LKRHVSSLGQ 234
                .|: ||:.:..|.:
Human   336 ----FPLELKKRLKKLSE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 15/53 (28%)
LIM2_dLMO 156..210 CDD:188776 15/53 (28%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717
LIM2_PINCH 100..151 CDD:188718
LIM3_PINCH 164..214 CDD:188719
LIM4_PINCH 220..273 CDD:188720 15/55 (27%)
LIM5_PINCH 281..334 CDD:188721 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.