DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lmx1ba

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001349521.1 Gene:lmx1ba / 554361 ZFINID:ZDB-GENE-050114-3 Length:375 Species:Danio rerio


Alignment Length:286 Identity:82/286 - (28%)
Similarity:114/286 - (39%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            :|.||.:.|.||:|||..|..|||:||:|..|...|   ..:.|::.:.:.||.||.:||...  
Zfish    32 VCEGCHRPISDRFLLRMNDSSWHEECLQCSVCQQLL---TMSCYSRDHKLYCKHDYQQLFATK-- 91

  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMA 220
            |:.|.:.|...|:||||..:||||.||.|..|..|.|.||.|.|.|.::||:.|||.....||..
Zfish    92 CSGCLEKISPTELVMRALESVYHLSCFCCCVCERRLCKGDEFVLKEGQLLCKTDYEREKDLASPD 156

  Fly   221 NHPMLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQT- 284
            .....|.....|......||            ||.|.|:.:.    ..||.|       ..|:| 
Zfish   157 LSDSDKSEDEDLDVKPEKGA------------GGQGKGSDDS----KDPRRP-------KRPRTI 198

  Fly   285 -PTGGGSPFAAAAAAAAAAAHMKNQLGASSXNKALGMGAAGAVVPGSGVGAGVGVGVGAASQQFY 348
             .|.....|.|:...::.......:.                      :.|..|:.|......|.
Zfish   199 LTTQQRRAFKASFEVSSKPCRKVRET----------------------LAAETGLSVRVVQVWFQ 241

  Fly   349 SGFGLQHQHQHQQHHQQQQQQQQLMG 374
            :......:...:|..||:||..|.:|
Zfish   242 NQRAKMKKLARRQQQQQEQQNSQRLG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 25/53 (47%)
lmx1baNP_001349521.1 LIM1_Lmx1b 33..85 CDD:188757 22/54 (41%)
LIM 92..146 CDD:295319 25/53 (47%)
Homeobox 195..248 CDD:306543 9/74 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.