DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lmo3

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001315524.1 Gene:lmo3 / 553774 ZFINID:ZDB-GENE-050522-201 Length:167 Species:Danio rerio


Alignment Length:124 Identity:96/124 - (77%)
Similarity:108/124 - (87%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||||.:.|:|||||:|||..||||||||.||||||||||||||||.||:||:||||||||.||.|
Zfish    35 CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNC 99

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLV 215
            |||||:||||||||||:.|||||:|||||.||.||||||:|:|..|.|||:.||||.|:
Zfish   100 AACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLM 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 42/53 (79%)
LIM2_dLMO 156..210 CDD:188776 40/53 (75%)
lmo3NP_001315524.1 LIM1_LMO1_LMO3 35..89 CDD:188774 42/53 (79%)
LIM2_LMO1_LMO3 99..153 CDD:188775 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6103
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38552
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - otm26057
orthoMCL 1 0.900 - - OOG6_105630
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5205
SonicParanoid 1 1.000 - - X1872
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.