DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lims2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_021334342.1 Gene:lims2 / 553696 ZFINID:ZDB-GENE-050522-56 Length:378 Species:Danio rerio


Alignment Length:146 Identity:40/146 - (27%)
Similarity:68/146 - (46%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSQLCAGCGKHIQDRYLLRALDMLWHED---CLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRL 149
            |..:|..|.:.::.| ::.|:...||.:   |:|     |....:|...|.:..|..|:..|.:|
Zfish   235 GVPICGACRRPVEGR-VVNAMGKQWHVEHFVCVK-----CEKPFLGHRHYERKGLAYCETHYNQL 293

  Fly   150 FGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERL 214
            ||:.  |..|::||..  .|:.|....:.:.||:|..|..|..:.|:|...:.|.:|::.||.  
Zfish   294 FGDV--CFQCNRVIEG--DVVSALNKAWCVRCFSCSTCTSRLTLKDKFVEIDLKPVCKHCYER-- 352

  Fly   215 VFASMANHPMLKRHVS 230
                |.:.  |||.:|
Zfish   353 ----MPDE--LKRRLS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/56 (23%)
LIM2_dLMO 156..210 CDD:188776 15/53 (28%)
lims2XP_021334342.1 LIM1_PINCH 57..115 CDD:188717
LIM2_PINCH 118..169 CDD:188718
LIM3_PINCH 182..231 CDD:188719
LIM4_PINCH 237..290 CDD:188720 13/58 (22%)
LIM5_PINCH 298..351 CDD:188721 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.