DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bx and pitx2

DIOPT Version :9

Sequence 1:	NP_001259687.1	Gene:	Bx / 32846	FlyBaseID:	FBgn0265598	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	NP_001017227.1	Gene:	pitx2 / 549981	XenbaseID:	XB-GENE-482492	Length:	345	Species:	Xenopus tropicalis

Alignment Length:	56	Identity:	22/56 - (39%)
Similarity:	27/56 - (48%)	Gaps:	7/56 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   336 VGVGVGAAS--QQFYSGFGLQHQHQHQQHHQQQQQQQQ-----LMGLGLGMGGGGG 384
            ||..:..||  .|.:.....||||.|||||.||.||.|     |:.:...:|...|
Frog    14 VGSKLATASSHHQHHHQQHQQHQHHHQQHHHQQHQQPQPQAVTLVSMASSLGQRSG 69

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
Bx	NP_001259687.1	LIM1_LMO1_LMO3	92..146	CDD:188774
Bx	NP_001259687.1	LIM2_dLMO	156..210	CDD:188776
pitx2	NP_001017227.1	XRCC4	<84..144	CDD:284132
		Homeobox	117..169	CDD:278475
		OAR	303..320	CDD:281777
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910