DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and limd1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001016606.1 Gene:limd1 / 549360 XenbaseID:XB-GENE-1017238 Length:593 Species:Xenopus tropicalis


Alignment Length:132 Identity:38/132 - (28%)
Similarity:56/132 - (42%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQD-RYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGY 155
            |..|.|.:.. ....:|:..|:|..|..|..|..:|.  |...|.....:.|:.|:|    .:|:
 Frog   397 CVKCSKGVYGANQACQAMGNLYHNGCFICSACSRKLR--GKAFYFVNGKVYCEEDFL----YSGF 455

  Fly   156 ------CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCV-GDRFYL-CENKILCEYDYEE 212
                  |..|...|  .:|:::|....:|..||.|..||.  |: |..|.: .||||.|..||.:
 Frog   456 HQSADRCFVCGHWI--MDMILQALGKSFHPGCFRCAVCNE--CLDGVPFTVDMENKIYCVKDYHK 516

  Fly   213 RL 214
            .|
 Frog   517 IL 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/54 (24%)
LIM2_dLMO 156..210 CDD:188776 19/55 (35%)
limd1NP_001016606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..336
LIM1_Ajuba_like 397..450 CDD:188738 13/54 (24%)
LIM2_Ajuba_like 462..514 CDD:188741 19/55 (35%)
LIM3_Ajuba_like 522..583 CDD:188822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.