DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lhx5

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001016082.1 Gene:lhx5 / 548836 XenbaseID:XB-GENE-490400 Length:402 Species:Xenopus tropicalis


Alignment Length:233 Identity:67/233 - (28%)
Similarity:96/233 - (41%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156
            ||||.:.|.||:||..||..||..|::|..|.|.|.|   ..:::...:.||.|:.|.||..  |
 Frog     5 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTE---KCFSREGKLYCKTDFFRRFGTK--C 64

  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC-ENKILCEYDY-------EER 213
            |.||..|...::|.:||..|:||.||.|..||.:...|:..|:. |||.:|:.||       |..
 Frog    65 AGCSLGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYASASSLKESS 129

  Fly   214 LVFASMAN----HPMLKRHVSSLGQGSPTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGD 274
            |...|...    .|.|:..:....:.:....:..:.||                   |......:
 Frog   130 LNSVSSCTDRSLSPDLQDPIQDESKETDHSTSSDKETA-------------------NNENEEQN 175

  Fly   275 HNNNNNGPQTPTGG---GSPFAAAAAAAAAAAHMKNQL 309
            ......||:|....   .:..||.||......|::.||
 Frog   176 SGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 22/54 (41%)
lhx5NP_001016082.1 LIM1_Lhx1_Lhx5 5..56 CDD:188753 21/53 (40%)
LIM2_Lhx1_Lhx5 64..119 CDD:188761 22/54 (41%)
Homeobox 183..237 CDD:365835 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.