DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lhx8

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_012816489.1 Gene:lhx8 / 548653 XenbaseID:XB-GENE-494997 Length:385 Species:Xenopus tropicalis


Alignment Length:155 Identity:60/155 - (38%)
Similarity:79/155 - (50%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF 150
            |.|..:|:.||..|.|:|||:..|:.||..||.|..|...||. .::.|.|...:.||.||.|.:
 Frog    98 NQGKSVCSNCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGR-HTSCYIKDKDIYCKLDYFRRY 161

  Fly   151 GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLV 215
            |..  |:.|.:.|.|.:.|.||:.|||||.||||..|..:...|:.|.|.|.|:||...|:..| 
 Frog   162 GTR--CSRCGRHIHATDWVRRAKGNVYHLACFACYSCKRQLSTGEEFALVEEKVLCRVHYDCML- 223

  Fly   216 FASMANHPMLKRHVSSLGQGSPTGA 240
                   ..|||.|.:..:.|..||
 Frog   224 -------DNLKRAVENGNRVSVEGA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 21/53 (40%)
LIM2_dLMO 156..210 CDD:188776 24/53 (45%)
lhx8XP_012816489.1 LIM1_Lhx7_Lhx8 103..158 CDD:188767 22/55 (40%)
LIM2_Lhx7_Lhx8 165..219 CDD:188769 24/53 (45%)
Homeobox 258..311 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.