DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lmo4.2

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001015822.1 Gene:lmo4.2 / 548539 XenbaseID:XB-GENE-479327 Length:167 Species:Xenopus tropicalis


Alignment Length:147 Identity:69/147 - (46%)
Similarity:97/147 - (65%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYL 147
            ::|....:.|||||..|.||:||.:::..||..||||.||..:|||:|::.|||..::||:.||:
 Frog    15 SSNGGPPKACAGCGGKIADRFLLYSMERYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYI 79

  Fly   148 RLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEE 212
            ||||::|.|:||.:.|||.||||||:.:||||:||.|..|.:|...||||:.....|.||:|...
 Frog    80 RLFGSSGACSACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGAIFCEHDRPT 144

  Fly   213 RLVFASM----ANHPML 225
            .|:...:    :|.|||
 Frog   145 GLLSGHLNPLQSNPPML 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 27/53 (51%)
LIM2_dLMO 156..210 CDD:188776 28/53 (53%)
lmo4.2NP_001015822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/4 (25%)
LIM1_LMO4 24..78 CDD:188772 27/53 (51%)
LIM2_LMO4 88..142 CDD:188773 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.