DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and pdlim5

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_012817118.2 Gene:pdlim5 / 548530 XenbaseID:XB-GENE-854114 Length:884 Species:Xenopus tropicalis


Alignment Length:169 Identity:47/169 - (27%)
Similarity:68/169 - (40%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NNGNGNVQSIAAAANNNNNNN---------------------NNGSQLCAGCGKHIQDRYLLRAL 108
            ||.:..|:.:|      ||.:                     ...:.:||.|.|.|:..:|| ||
 Frog   666 NNASNAVKPVA------NNKSVPPPWIEDQDTLVQRAEHIPAGTRTPMCAICNKVIRGPFLL-AL 723

  Fly   109 DMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRAR 173
            ...||.:...|..|...:.|:| .:..||.| .|:..|.:||...  ||.|.:.|  ...|:.|.
 Frog   724 GKSWHPEEFNCAHCKSSMAEMG-FVEEKGGL-YCEICYEKLFAPE--CARCQRKI--LGEVINAL 782

  Fly   174 TNVYHLECFACQQCNH--RFCVGDRFYLCENKILCEYDY 210
            ...:|:.||.|..|..  |..|   |:|.:.:..||.||
 Frog   783 KQTWHVSCFVCVACQTPIRNSV---FHLEDGEPYCETDY 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 19/53 (36%)
LIM2_dLMO 156..210 CDD:188776 17/55 (31%)
pdlim5XP_012817118.2 PDZ 10..83 CDD:214570
PRK14951 <80..216 CDD:237865
DUF4749 212..320 CDD:406377
LIM1_ENH 708..759 CDD:188837 19/53 (36%)
LIM2_Enigma_like 767..818 CDD:188748 17/55 (31%)
LIM3_ENH 826..880 CDD:188843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.