DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and LIMA1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001107018.1 Gene:LIMA1 / 51474 HGNCID:24636 Length:760 Species:Homo sapiens


Alignment Length:189 Identity:37/189 - (19%)
Similarity:66/189 - (34%) Gaps:50/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 CAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEERLVFASMA 220
            |..|.|.:...|.:: |...|:|:.||.|..||::..:| .:.....:|.|:..:.:  :|.|..
Human   391 CVECQKTVYPMERLL-ANQQVFHISCFRCSYCNNKLSLG-TYASLHGRIYCKPHFNQ--LFKSKG 451

  Fly   221 N------HPMLKRHVSSLGQGS-----PTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGD 274
            |      |...|...:|..:..     |...|.|:.|                      |.:||.
Human   452 NYDEGFGHRPHKDLWASKNENEEILERPAQLANARET----------------------PHSPGV 494

  Fly   275 HNNNNNGPQTPTGGGSPFAAAAAAAAAAAHMKNQLGASSXNKALG------MGAAGAVV 327
            .:       .|.......||:..|.|::...|....|.: ...:.      :|::|:.:
Human   495 ED-------APIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSAL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774
LIM2_dLMO 156..210 CDD:188776 15/53 (28%)
LIMA1NP_001107018.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..131
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..182
Required for interaction with NPC1L1. /evidence=ECO:0000250|UniProtKB:Q9ERG0 164..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..264
LIM_Eplin_alpha_beta 391..443 CDD:188869 15/53 (28%)
Required for interaction with MYO5B. /evidence=ECO:0000250|UniProtKB:Q9ERG0 494..514 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..710 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.