DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and PAX7

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_002575.1 Gene:PAX7 / 5081 HGNCID:8621 Length:520 Species:Homo sapiens


Alignment Length:150 Identity:33/150 - (22%)
Similarity:56/150 - (37%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SSLGQGSPTGAAGAQNTAGGLLGGGPGGGNVNGVGMVNGPRTPGDHNN---NNNGPQTPTGGGSP 291
            |::.||....||.|.:|:...  |.....:......:| |..|.:|.|   |...||..:..|:|
Human   332 STMHQGGLAAAAAAADTSSAY--GARHSFSSYSDSFMN-PAAPSNHMNPVSNGLSPQVMSILGNP 393

  Fly   292 FAAAAAAAA--AAAHMKNQLGASSXNKALGMGAAGAVVPGSGVGAGVGVGVGAASQQF----YSG 350
            .|......|  :.:.:...|.::: ..|.....|.::.||..:         ..||.:    ||.
Human   394 SAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSL---------PTSQAYCPPTYST 449

  Fly   351 FGLQHQ----HQHQQHHQQQ 366
            .|....    :|:.|:.|.:
Human   450 TGYSVDPVAGYQYGQYGQSE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774
LIM2_dLMO 156..210 CDD:188776
PAX7NP_002575.1 paired box domain 34..164
PAX 34..163 CDD:238076
octapeptide 86..93
paired homeodomain 217..275
Homeobox 220..273 CDD:278475
Pax7 347..385 CDD:289156 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.