DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and Lims1

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017457250.1 Gene:Lims1 / 499443 RGDID:1560732 Length:407 Species:Rattus norvegicus


Alignment Length:125 Identity:37/125 - (29%)
Similarity:62/125 - (49%) Gaps:7/125 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGN 152
            |..:|..|.:.|:.| ::.|:...||.:...|..|:...  :|...|.:..|..|:..|.:|||:
  Rat   260 GVPICGACRRPIEGR-VVNAMGKQWHVEHFVCAKCEKPF--LGHRHYERKGLAYCETHYNQLFGD 321

  Fly   153 TGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDYEE 212
            .  |..|::||..  .|:.|....:.:.||||..||.:..:.|:|...:.|.:|:|.||:
  Rat   322 V--CFHCNRVIEG--DVVSALNKAWCVSCFACSTCNTKLTLKDKFVAIDLKPVCKYCYEK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 13/53 (25%)
LIM2_dLMO 156..210 CDD:188776 17/53 (32%)
Lims1XP_017457250.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.