DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bx and lhx6a

DIOPT Version :9

Sequence 1:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001004015.1 Gene:lhx6a / 445565 ZFINID:ZDB-GENE-041025-1 Length:375 Species:Danio rerio


Alignment Length:227 Identity:71/227 - (31%)
Similarity:98/227 - (43%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGLVGLSSNQQQQQQQQS--QQSNAGMNSGGQNNGPNPNGNGNVVNVVNSGGAGGGNNGNGNVQS 73
            ||.......|..|...||  :...:.|......:.|:|                      .:..|
Zfish    36 PGASRCVDGQHGQAMSQSDGESHRSNMEKDDTRSSPSP----------------------PSTPS 78

  Fly    74 IAAAANNNNNNNNNGSQLCAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGN 138
            |.:..:..::..:.|..:||.||..|.|||||:..:::||..||:|..|...|.: .|:.|.|..
Zfish    79 ICSPTSTASSVPSTGKNVCASCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQ-HSSCYIKNK 142

  Fly   139 LMLCKRDYLRLFGNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENK 203
            .:.||.||...||..  ||.|.:.|.|.:.|.|||.|.|||.||||..|..:...|:.|.|.|.|
Zfish   143 EIFCKMDYFSRFGTK--CARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEK 205

  Fly   204 ILCEYDYEERLVFASMANHPMLKRHVSSLGQG 235
            :||...|:      :|..:  |||...| |.|
Zfish   206 VLCRIHYD------TMVEN--LKRAAES-GSG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 22/53 (42%)
LIM2_dLMO 156..210 CDD:188776 25/53 (47%)
lhx6aNP_001004015.1 LIM1_Lhx6 97..150 CDD:188766 22/53 (42%)
LIM2_Lhx6 158..212 CDD:188768 25/53 (47%)
Homeobox 250..302 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.